LL-37 5mg
Product Name: LL-37 Strength: 5mg Full Name: Human Cathelicidin LL-37 Alternative Names: LL37, Cathelicidin Antimicrobial Peptide, hCAP-18 Derived Peptide Research Category: Antimicrobial Peptide / Innate Immunity Research CAS Number: 154947-66-7 Peptide Type: Synthetic 37-Amino-Acid Peptide Sequence: [LL-37, 37 aa] Research Interest: Innate immune signaling, antimicrobial activity, host-defense mechanisms, inflammatory pathways, epithelial biology, cellular migration, and wound-response research. Description
LL-37 is a 37-amino-acid peptide derived from the human cathelicidin precursor protein hCAP-18. It is an important component of innate immune defense and has been extensively investigated for its antimicrobial and immunomodulatory properties. Mechanism of Research
LL-37 is studied for its ability to interact with microbial membranes and influence several host-cell signaling pathways. Research has examined its effects on membrane integrity, inflammatory signaling, immune-cell responses, chemotaxis, epithelial activity, and cellular migration. Research Applications
Research involving LL-37 includes antimicrobial peptide biology, bacterial and microbial interactions, innate immune responses, inflammatory signaling, epithelial defense, cellular migration, host-defense mechanisms, and wound-response pathways. Storage
Storage requirements depend on the formulation and supplier. Research material should be stored according to the accompanying certificate of analysis (COA), product specification sheet, and manufacturer instructions. Research Use Disclaimer
LL-37 is an investigational research peptide. Information provided here is for scientific and research reference purposes only and should not be interpreted as medical, prescribing, or dosing advice. 
